PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_04D939077.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 301aa    MW: 32701.3 Da    PI: 7.9765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_04D939077.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-171661348
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            W++eEde+lv++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Traes_7AL_04D939077.1 16 LWSPEEDEKLVRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                           6*******************************************97 PP

2Myb_DNA-binding55.51.3e-1767111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rgr+++eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  Traes_7AL_04D939077.1  67 RGRFSPEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                            89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.227961IPR017930Myb domain
SuperFamilySSF466891.53E-2912108IPR009057Homeodomain-like
SMARTSM007179.5E-121363IPR001005SANT/Myb domain
PfamPF002497.6E-151561IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-241568IPR009057Homeodomain-like
CDDcd001675.13E-121761No hitNo description
PROSITE profilePS5129425.94562116IPR017930Myb domain
SMARTSM007172.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.2E-1667111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2569116IPR009057Homeodomain-like
CDDcd001671.32E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKGGLWSPE EDEKLVRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SPEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKAP  120
AAPNVTTTSS TTSTSPPNNG LAPCSGSTAT SDVHHRRLQH PTFSCAPAGD HLQLDAIIGH  180
HQSTSLALPV AAGAGQDSPP GMSHHCPLFM FDTGVVSTPF ASAAAQQHPF IASFTAAMAE  240
ADTPSCYHLP PLVDGMGAMG MCMEAMDDHX XXXXXXXXXX XXXXXXXXXX XXGGGGAARA  300
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26151168108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118081e-153AK111808.1 Oryza sativa Japonica Group cDNA clone:J013114D05, full insert sequence.
GenBankAK1121171e-153AK112117.1 Oryza sativa Japonica Group cDNA clone:002-129-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755642.11e-124PREDICTED: myb-related protein Zm38
SwissprotQ9SPG34e-64MYB26_ARATH; Transcription factor MYB26
TrEMBLW5H5Y10.0W5H5Y1_WHEAT; Uncharacterized protein
STRINGMLOC_16981.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.13e-79myb domain protein 103
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]